| Edit |   |
|---|
| Antigenic Specificity | DAZ3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DAZ3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DAZ3. This antibody reacts with human. The DAZ3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to DAZ3(deleted in azoospermia 3) The peptide sequence was selected from the middle region of DAZ3. Peptide sequence PFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAF. |
|---|
| Other Names | deleted in azoospermia 3, deleted in azoospermia protein 3, MGC126441, pDP1679 |
|---|
| Gene, Accession # | DAZ3, Gene ID: 57054, Accession: Q2KHN7, SwissProt: Q2KHN7 |
|---|
| Catalog # | NBP1-57409 |
|---|
| Price | |
|---|
| Order / More Info | DAZ3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|