| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GDF-15 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GDF-15 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GDF-15. This antibody reacts with human. The GDF-15 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHC |
|---|
| Other Names | growth differentiation factor 15, growth/differentiation factor 15, Macrophage inhibitory cytokine 1, MIC-1NSAID-activated gene 1 protein, MIC1Prostate differentiation factor, NAG-1NSAID-regulated gene 1 protein, NSAID (nonsteroidal inflammatory drug)-activated protein 1, PDFGDF-15, PLABNRG-1, Placental bone morphogenetic protein, Placental TGF-beta, PTGFBPTGF-beta |
|---|
| Gene, Accession # | GDF15, Gene ID: 9518 |
|---|
| Catalog # | NBP2-68911 |
|---|
| Price | |
|---|
| Order / More Info | GDF-15 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|