| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Myosin Phosphatase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Myosin Phosphatase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Myosin Phosphatase. This antibody reacts with human. The Myosin Phosphatase Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Myosin Phosphatase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GVSFWTQDSDENEQEQQSDTEEGSNKKETQTDSISRYETSSTSAGDRYDSLLGRSGSYSYLEERKPYSSRLEKDDSTDFKKLYEQILAENEELK |
|---|
| Other Names | MBSmyosin phosphatase, target subunit 1, MGC133042, Myosin phosphatase target subunit 1, Myosin phosphatase-targeting subunit 1, MYPT1protein phosphatase 1 regulatory subunit 12A, protein phosphatase 1, regulatory (inhibitor) subunit 12A, Protein phosphatase myosin-binding subunit |
|---|
| Gene, Accession # | PPP1R12A, Gene ID: 4659 |
|---|
| Catalog # | NBP2-58950 |
|---|
| Price | |
|---|
| Order / More Info | Myosin Phosphatase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|