| 产品详情 |
| Edit |   |
| Antigenic Specificity | Myotilin |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Myotilin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Myotilin. This antibody reacts with human. The Myotilin Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, Myotilin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ACVAKNRAGEATFTVQLDVLAKEHKRAPMFIYKPQSKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAG |
| Other Names | 57 kDa cytoskeletal protein, LGMD1A, limb-girdle muscular dystrophy 1A (autosomal dominant), Myofibrillar titin-like Ig domains protein, myotilin, Titin immunoglobulin domain protein, titin immunoglobulin domain protein (myotilin), TTIDLGMD1 |
| Gene, Accession # | MYOT, Gene ID: 9499, Accession: Q9UBF9, SwissProt: Q9UBF9 |
| Catalog # | NBP2-38361 |
| Price | |
| Order / More Info | Myotilin Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|