| Edit |   |
|---|
| Antigenic Specificity | RAR beta/NR1B2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 25 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. IHC reported in the literature (PMID: 26634247) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RAR beta/NR1B2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RAR beta/NR1B2. This antibody reacts with human. The RAR beta/NR1B2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGV |
|---|
| Other Names | beta polypeptide, HBV-activated protein, retinoic acid receptor, beta |
|---|
| Gene, Accession # | RARB, Gene ID: 5915 |
|---|
| Catalog # | NBP1-81776-25ul |
|---|
| Price | |
|---|
| Order / More Info | RAR beta/NR1B2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26634247 |
|---|