| Edit |   |
| Antigenic Specificity | RARRES1 |
| Clone | 2E2 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA. It has been used for ELISA and WB. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RARRES1 Antibody (2E2) from Novus Biologicals is a mouse monoclonal antibody to RARRES1. This antibody reacts with human. The RARRES1 Antibody (2E2) has been validated for the following applications: Western Blot, ELISA. |
| Immunogen | RARRES1 (NP_996846 205 a.a. - 294 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EMTTQVSHYYLAQLTSVRQWKTNDDTIDFDYTVLLHELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGTEEGSAVVPTELSNF |
| Other Names | RAR-responsive protein TIG1, retinoic acid receptor responder (tazarotene induced) 1, retinoic acid receptor responder protein 1, TIG1Tazarotene-induced gene 1 protein |
| Gene, Accession # | RARRES1, Gene ID: 5918, Accession: NP_996846, SwissProt: NP_996846 |
| Catalog # | H00005918-M06 |
| Price | |
| Order / More Info | RARRES1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |