| Edit |   |
|---|
| Antigenic Specificity | GAMT |
|---|
| Clone | 3H4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GAMT Antibody (3H4) from Novus Biologicals is a mouse monoclonal antibody to GAMT. This antibody reacts with human. The GAMT Antibody (3H4) has been validated for the following applications: ELISA. |
|---|
| Immunogen | GAMT (NP_000147.1, 138 a.a. - 235 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTK |
|---|
| Other Names | EC 2.1.1.2, guanidinoacetate N-methyltransferase, PIG2, TP53I2 |
|---|
| Gene, Accession # | GAMT, Gene ID: 2593, Accession: NP_000147, SwissProt: NP_000147 |
|---|
| Catalog # | H00002593-M04 |
|---|
| Price | |
|---|
| Order / More Info | GAMT Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|