| Edit |   |
|---|
| Antigenic Specificity | GAMT |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GAMT Antibody from Novus Biologicals is a rabbit polyclonal antibody to GAMT. This antibody reacts with human. The GAMT Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptides corresponding to GAMT(guanidinoacetate N-methyltransferase) The peptide sequence was selected from the middle region of GAMT. Peptide sequence PGEGPFLTPWVGWTVLVHLEIKVLCLAQWLPGAVAQVYNPSTVEGRGGQI. |
|---|
| Other Names | EC 2.1.1.2, guanidinoacetate N-methyltransferase, PIG2, TP53I2 |
|---|
| Gene, Accession # | GAMT, Gene ID: 2593, Accession: A8K0A0, SwissProt: A8K0A0 |
|---|
| Catalog # | NBP1-54399 |
|---|
| Price | |
|---|
| Order / More Info | GAMT Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|