| Edit |   |
| Antigenic Specificity | CENPP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CENPP Antibody from Novus Biologicals is a rabbit polyclonal antibody to CENPP. This antibody reacts with human. The CENPP Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CENPP(centromere protein P) The peptide sequence was selected from the N terminal of CENPP. Peptide sequence VQKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFLSTLTGINIRNHSKQ. |
| Other Names | CENP-PRP11-19J3.3, centromere protein P, FLJ33928 |
| Gene, Accession # | CENPP, Gene ID: 401541, Accession: Q6IPU0, SwissProt: Q6IPU0 |
| Catalog # | NBP1-53064 |
| Price | |
| Order / More Info | CENPP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |