| Edit |   |
| Antigenic Specificity | LOC645015 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LOC645015 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LOC645015. This antibody reacts with human. The LOC645015 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LOC645015(similar to mannosyltransferase) The peptide sequence was selected from the middle region of LOC645015. Peptide sequence LPSLVCVITGQGPLTEYYSRPIHQKHFQHIQVCNPWLEAEDYPLLLGSVD. |
| Other Names | asparagine-linked glycosylation 1-like 8, pseudogene, LOC645015 asparagine-linked glycosylation 1 homolog pseudogene |
| Gene, Accession # | LOC645015, Gene ID: 645015 |
| Catalog # | NBP1-70612 |
| Price | |
| Order / More Info | LOC645015 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |