| Edit |   |
|---|
| Antigenic Specificity | LOC647169 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LOC647169 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LOC647169. This antibody reacts with human. The LOC647169 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LOC647169(similar to glutathione transferase) The peptide sequence was selected from the C terminal of LOC647169. Peptide sequence KAVLCALRALKIRISKLPTVKKFLQPGSLRKLPIDAKGLQEATKIFKV. |
|---|
| Other Names | LOC647169 glutathione S-transferase alpha 3 pseudogene |
|---|
| Gene, Accession # | LOC647169, Gene ID: 647169 |
|---|
| Catalog # | NBP1-70614 |
|---|
| Price | |
|---|
| Order / More Info | LOC647169 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|