| Edit |   |
| Antigenic Specificity | LOC684800 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LOC684800 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LOC684800. This antibody reacts with rat. The LOC684800 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human LOC684800. Peptide sequence MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGV. |
| Other Names | similar to stromal membrane-associated protein 1 |
| Gene, Accession # | LOC684800, Gene ID: 684800, Accession: XP_002727223 |
| Catalog # | NBP1-91475 |
| Price | |
| Order / More Info | LOC684800 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |