| Edit |   |
| Antigenic Specificity | LOH12CR1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LOH12CR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LOH12CR1. This antibody reacts with human. The LOH12CR1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human LOH12CR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VIKLQEIPTFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDL |
| Other Names | LOH1CR12, loss of heterozygosity 12 chromosomal region 1 protein, loss of heterozygosity, 12, chromosomal region 1 |
| Gene, Accession # | LOH12CR1, Gene ID: 118426, Accession: Q969J3, SwissProt: Q969J3 |
| Catalog # | NBP2-30419 |
| Price | |
| Order / More Info | LOH12CR1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |