| Edit |   |
|---|
| Antigenic Specificity | LOC684800 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LOC684800 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LOC684800. This antibody reacts with rat. The LOC684800 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human LOC684800. Peptide sequence MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGV. |
|---|
| Other Names | similar to stromal membrane-associated protein 1 |
|---|
| Gene, Accession # | LOC684800, Gene ID: 684800, Accession: XP_002727223 |
|---|
| Catalog # | NBP1-91475-20ul |
|---|
| Price | |
|---|
| Order / More Info | LOC684800 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|