| Edit |   |
|---|
| Antigenic Specificity | CENPQ |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CENPQ Antibody from Novus Biologicals is a rabbit polyclonal antibody to CENPQ. This antibody reacts with human. The CENPQ Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CENPQ(centromere protein Q) The peptide sequence was selected from the N terminal of CENPQ. Peptide sequence VRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKRKTWQPLSKSTRDHL. |
|---|
| Other Names | C6orf139, CENP-QFLJ10545, centromere protein Q, chromosome 6 open reading frame 139 |
|---|
| Gene, Accession # | CENPQ, Gene ID: 55166, Accession: Q7L2Z9, SwissProt: Q7L2Z9 |
|---|
| Catalog # | NBP1-55216 |
|---|
| Price | |
|---|
| Order / More Info | CENPQ Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|