| 产品详情 |
| Edit |   |
| Antigenic Specificity | Common gamma Chain/IL-2 R gamma |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Common gamma Chain/IL-2 R gamma Antibody from Novus Biologicals is a rabbit polyclonal antibody to Common gamma Chain/IL-2 R gamma. This antibody reacts with human. The Common gamma Chain/IL-2 R gamma Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Common gamma Chain/IL-2R gamma/CD132 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNC TWNSSSEPQPTNLTLHYWYKNSDNDK |
| Other Names | CD132, CD132 antigen, CIDX, combined immunodeficiency, X-linked, common cytokine receptor gamma chain, common gamma-chain, cytokine receptor common subunit gamma, gamma(c), IL-2 receptor subunit gamma, IL-2R subunit gamma, IL-2RG, IMD4, interleukin 2 receptor, gamma, Interleukin-2 receptor subunit gamma, p64, SCIDX, SCIDX1, severe combined immunodeficiency |
| Gene, Accession # | IL2RG, Gene ID: 3561 |
| Catalog # | NBP2-14122 |
| Price | |
| Order / More Info | Common gamma Chain/IL-2 R gamma Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|