| Edit |   |
|---|
| Antigenic Specificity | LPP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, dog, horse, rabbit, bovine |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-LPP Antibody |
|---|
| Immunogen | The immunogen for Anti-LPP Antibody: synthetic peptide directed towards the N terminal of human LPP. Synthetic peptide located within the following region: GKTLEERRSSLDAEIDSLTSILADLECSSPYKPRPPQSSTGSTASPPVST |
|---|
| Other Names | LIM domain containing preferred translocation partner in lipoma |
|---|
| Gene, Accession # | LPP, Accession: NM_005578 |
|---|
| Catalog # | TA335709 |
|---|
| Price | |
|---|
| Order / More Info | LPP Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|