| Edit |   |
|---|
| Antigenic Specificity | CEP63 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CEP63 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CEP63. This antibody reacts with human. The CEP63 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CEP63 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LKRMEAHNNEYKAEIKKLKEQILQGEQSYSSALEGMKMEISHLTQELHQRDITIASTKGSSSDMEKRLRAEMQKAEDKAVEHKEILDQLESL |
|---|
| Other Names | centrosomal protein 63kDa, centrosomal protein of 63 kDa, centrosome protein CEP63, Cep63, FLJ13386, MGC78416 |
|---|
| Gene, Accession # | CEP63, Gene ID: 80254, Accession: Q96MT8, SwissProt: Q96MT8 |
|---|
| Catalog # | NBP2-31706 |
|---|
| Price | |
|---|
| Order / More Info | CEP63 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|