| Edit |   |
|---|
| Antigenic Specificity | TBC1D7 - C-terminal region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse; human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-TBC1D7 Antibody - C-terminal region |
|---|
| Immunogen | The immunogen for Anti-Tbc1d7 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Tbc1d7. Synthetic peptide located within the following region: ISRCFVKQLNNKYRDALPQLPKAFEQYLNLEDSRLLSHLKTCSAVSKLPY |
|---|
| Other Names | MGCPH, PIG51, TBC7, TBC1 domain family, member 7 |
|---|
| Gene, Accession # | TBCD7, Accession: NM_001143966 |
|---|
| Catalog # | TA345015 |
|---|
| Price | |
|---|
| Order / More Info | TBC1D7 - C-terminal region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|