| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | METTL10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The METTL10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to METTL10. This antibody reacts with human. The METTL10 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human METTL10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MSSGADGGGGAAVAARSDKGSPGEDGFVPSALGTREHWDAVYERELQTFR EYGDTGEIWFGEESMNRLIRWMQKHKIPL |
|---|
| Other Names | C10orf138, chromosome 10 open reading frame 138, EC 2.1.1.-, Em:AC068896.3, FLJ13019, methyltransferase like 10, methyltransferase-like protein 10 |
|---|
| Gene, Accession # | METTL10, Gene ID: 399818 |
|---|
| Catalog # | NBP2-14232 |
|---|
| Price | |
|---|
| Order / More Info | METTL10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|