| Edit |   |
| Antigenic Specificity | METTL14 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The METTL14 Antibody from Novus Biologicals is a rabbit polyclonal antibody to METTL14. This antibody reacts with human. The METTL14 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human KIAA1627. Peptide sequence LNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDEL. |
| Other Names | EC 2.1.1, EC 2.1.1.-, KIAA1627methyltransferase-like protein 14, methyltransferase like 14 |
| Gene, Accession # | METTL14, Gene ID: 57721, Accession: NP_066012, SwissProt: NP_066012 |
| Catalog # | NBP1-79389 |
| Price | |
| Order / More Info | METTL14 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |