| Edit |   |
|---|
| Antigenic Specificity | DUS1L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DUS1L Antibody from Novus Biologicals is a rabbit polyclonal antibody to DUS1L. This antibody reacts with human. The DUS1L Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to DUS1L (dihydrouridine synthase 1-like (S. cerevisiae)) The peptide sequence was selected from the middle region of DUS1L)(50ug). Peptide sequence KPTGDLPFHWICQPYIRPGPREGSKEKAGARSKRALEEEEGGTEVLSKNK. |
|---|
| Other Names | dihydrouridine synthase 1-like (S. cerevisiae), DUS1, PP3111, tRNA-dihydrouridine synthase 1-like |
|---|
| Gene, Accession # | DUS1L, Gene ID: 64118, Accession: Q6P1R4, SwissProt: Q6P1R4 |
|---|
| Catalog # | NBP1-57742-20ul |
|---|
| Price | |
|---|
| Order / More Info | DUS1L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|