| Edit |   |
| Antigenic Specificity | DUSP11 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DUSP11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DUSP11. This antibody reacts with mouse. The DUSP11 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to Dusp11 (dual specificity phosphatase 11 (RNA/RNP complex 1-interacting)) The peptide sequence was selected from the N terminal of Dusp11. Peptide sequence GQRMPGTRFIAFKVPLQKKFEAKLMPEECFSPLDLFNKIQEQNEELGL |
| Other Names | dual specificity phosphatase 11 (RNA/RNP complex 1-interacting), Dual specificity protein phosphatase 11, EC 3.1.3.-, Phosphatase that interacts with RNA/RNP complex 1, PIR1RNA/RNP complex-interacting phosphatase, RNA/RNP complex-1-interacting phosphatase, serine/threonine specific protein phosphatase |
| Gene, Accession # | DUSP11, Gene ID: 8446, Accession: Q6NXK5 |
| Catalog # | NBP1-68919 |
| Price | |
| Order / More Info | DUSP11 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |