| 产品详情 |
| Edit |   |
| Antigenic Specificity | DUSP14 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DUSP14 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DUSP14. This antibody reacts with human. The DUSP14 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DUSP14 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVS |
| Other Names | dual specificity phosphatase 14, EC 3.1.3.16, EC 3.1.3.48, MAP kinase phosphatase 6, Mitogen-activated protein kinase phosphatase 6, MKP-1 like protein tyrosine phosphatase, MKP-1-like protein tyrosine phosphatase, MKP-6, MKP6MKP-Ldual specificity protein phosphatase 14 |
| Gene, Accession # | DUSP14, Gene ID: 11072, Accession: O95147 |
| Catalog # | NBP1-81046 |
| Price | |
| Order / More Info | DUSP14 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|