| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DUSP19 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DUSP19 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DUSP19. This antibody reacts with human. The DUSP19 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DUSP19 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTL |
|---|
| Other Names | dual specificity phosphatase 19, Dual specificity phosphatase TS-DSP1, dual specificity protein phosphatase 19, DUSP17SAPK pathway-regulating phosphatase 1, EC 3.1.3.16, EC 3.1.3.48, LMWDSP3, LMW-DSP3, Low molecular weight dual specificity phosphatase 3, Protein phosphatase SKRP1, SKRP1MGC138210, Stress-activated protein kinase pathway-regulating phosphatase 1, TS-DSP1 |
|---|
| Gene, Accession # | DUSP19, Gene ID: 142679 |
|---|
| Catalog # | NBP1-84041 |
|---|
| Price | |
|---|
| Order / More Info | DUSP19 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|