| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DUSP22 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DUSP22 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DUSP22. This antibody reacts with human. The DUSP22 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DUSP22 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFW |
|---|
| Other Names | dual specificity phosphatase 22, dual specificity protein phosphatase 22, EC 3.1.3.16, EC 3.1.3.48, FLJ35864, homolog of mouse dual specificity phosphatase LMW-DSP2, JKAP, JNK-stimulating phosphatase 1, JSP-1, JSP1JNK-stimulatory phosphatase-1, LMWDSP2, LMW-DSP2, Low molecular weight dual specificity phosphatase 2, Mitogen-activated protein kinase phosphatase x, MKP-x, MKPXMAP kinase phosphatase x, VHX |
|---|
| Gene, Accession # | DUSP22, Gene ID: 56940 |
|---|
| Catalog # | NBP1-83078 |
|---|
| Price | |
|---|
| Order / More Info | DUSP22 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|