| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DUSP22 |
|---|
| Clone | 3D3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, RNA Inhibition. Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for RNAi validation and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DUSP22 Antibody (3D3) from Novus Biologicals is a mouse monoclonal antibody to DUSP22. This antibody reacts with human. The DUSP22 Antibody (3D3) has been validated for the following applications: Western Blot, ELISA, RNA Inhibition. |
|---|
| Immunogen | DUSP22 (NP_064570, 112 a.a. 185 a.a) partial recombinant protein with GST tag.EDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEE YGESPLQDAEEAKNILAAPGILKFWAFLRRL |
|---|
| Other Names | dual specificity phosphatase 22, dual specificity protein phosphatase 22, EC 3.1.3.16, EC 3.1.3.48, FLJ35864, homolog of mouse dual specificity phosphatase LMW-DSP2, JKAP, JNK-stimulating phosphatase 1, JSP-1, JSP1JNK-stimulatory phosphatase-1, LMWDSP2, LMW-DSP2, Low molecular weight dual specificity phosphatase 2, Mitogen-activated protein kinase phosphatase x, MKP-x, MKPXMAP kinase phosphatase x, VHX |
|---|
| Gene, Accession # | DUSP22, Gene ID: 56940, Accession: NP_064570, SwissProt: NP_064570 |
|---|
| Catalog # | H00056940-M01 |
|---|
| Price | |
|---|
| Order / More Info | DUSP22 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 2001884, 20018849, 24436131 |
|---|
| 产品资料 |
|
|