| 产品详情 |
| Edit |   |
| Antigenic Specificity | Methionyl tRNA synthetase 2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Methionyl tRNA synthetase 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Methionyl tRNA synthetase 2. This antibody reacts with human. The Methionyl tRNA synthetase 2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Methionyl tRNA synthetase 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LLNSELADALGGLLNRCTAKRINPSETYPAFCTTCFPSEPGLVGPSVRAQAEDYALVSAVATLPKQVADHYDNFRIYKALEAVSSCVRQTNG |
| Other Names | EC 6.1.1, EC 6.1.1.10, methionine tRNA ligase 2, mitochondrial, methionine-tRNA ligase, Methionine--tRNA ligase 2, methionine-tRNA synthetase 2 (mitochondrial), methionine-tRNA synthetase 2, mitochondrial, methionyl-tRNA synthetase 2, mitochondrial, methionyl-tRNA synthetase, mitochondrial, MetRS, Mitochondrial methionine--tRNA ligase, mitochondrial methionyl-tRNA synthetase, mtMetRS |
| Gene, Accession # | MARS2, Gene ID: 92935, Accession: Q96GW9, SwissProt: Q96GW9 |
| Catalog # | NBP2-34013 |
| Price | |
| Order / More Info | Methionyl tRNA synthetase 2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|