| Edit |   |
|---|
| Antigenic Specificity | FAM46C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM46C Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM46C. This antibody reacts with human. The FAM46C Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to FAM46C(family with sequence similarity 46, member C) The peptide sequence was selected from the middle region of FAM46C. Peptide sequence LIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFP. |
|---|
| Other Names | family with sequence similarity 46, member C, FLJ20202, hypothetical protein LOC54855 |
|---|
| Gene, Accession # | FAM46C, Gene ID: 54855, Accession: Q5VWP2, SwissProt: Q5VWP2 |
|---|
| Catalog # | NBP1-57697 |
|---|
| Price | |
|---|
| Order / More Info | FAM46C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|