| Edit |   |
|---|
| Antigenic Specificity | FAM5C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM5C Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM5C. This antibody reacts with human. The FAM5C Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human FAM5C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FLYCNENGLLGSFSEETHSCTCPNDQVVCTAFLPCTVGDASACLTCAPDNRTR |
|---|
| Other Names | DBCCR1LDBCCR1L1BRINP3, DBCCR1-like protein 1, family with sequence similarity 5, member C, RP11-445K1.1 |
|---|
| Gene, Accession # | FAM5C, Gene ID: 339479, Accession: Q76B58, SwissProt: Q76B58 |
|---|
| Catalog # | NBP2-31581 |
|---|
| Price | |
|---|
| Order / More Info | FAM5C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|