| Edit |   |
|---|
| Antigenic Specificity | FAM26F |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM26F Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM26F. This antibody reacts with human. The FAM26F Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human FAM26F. Peptide sequence NRSCAAELPLVPCNQAKASDVQDLLKDLKAQSQVLGWILIAVVIIILLIF. |
|---|
| Other Names | family with sequence similarity 26, member F |
|---|
| Gene, Accession # | FAM26F, Gene ID: 441168, Accession: NP_001010919, SwissProt: NP_001010919 |
|---|
| Catalog # | NBP1-80539 |
|---|
| Price | |
|---|
| Order / More Info | FAM26F Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|