| Edit |   |
| Antigenic Specificity | FAM83F |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FAM83F Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM83F. This antibody reacts with human. The FAM83F Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human FAM83FThe immunogen for this antibody is FAM83F. Peptide sequence KDEKAPHLKQVVRQMIQQAQKVIAVVMDLFTDGDIFQDIVDAACKRRVPV. |
| Other Names | family with sequence similarity 83, member F, hypothetical protein LOC113828 |
| Gene, Accession # | FAM83F, Gene ID: 113828, Accession: NP_612444, SwissProt: NP_612444 |
| Catalog # | NBP1-79503-20ul |
| Price | |
| Order / More Info | FAM83F Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |