| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC10A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC10A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC10A1. This antibody reacts with human. The SLC10A1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SLC10A1(solute carrier family 10 (sodium/bile acid cotransporter family), member 1) The peptide sequence was selected from the middle region of SLC10A1 (NP_003040). Peptide sequence VFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLY |
|---|
| Other Names | Cell growth-inhibiting gene 29 protein, Na(+)/bile acid cotransporter, Na(+)/taurocholate transport protein, Na/taurocholate cotransporting polypeptide, NTCP, NTCP1, NTCPgrowth-inhibiting protein 29, sodium/bile acid cotransporter, sodium/taurocholate cotransporter, Sodium/taurocholate cotransporting polypeptide, solute carrier family 10 (sodium/bile acid cotransporter family), member 1, Solute carrier family 10 member 1 |
|---|
| Gene, Accession # | SLC10A1, Gene ID: 6554, Accession: Q14973, SwissProt: Q14973 |
|---|
| Catalog # | NBP1-60109 |
|---|
| Price | |
|---|
| Order / More Info | SLC10A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|