| Edit |   |
| Antigenic Specificity | FAM78B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FAM78B Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM78B. This antibody reacts with human. The FAM78B Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to FAM78B(family with sequence similarity 78, member B) The peptide sequence was selected from the middle region of FAM78B. Peptide sequence PSVTWAVPVSDSNVPLLTRIKRDQSFTTWLVAMNTTTKEKIILQTIKWRM. |
| Other Names | family with sequence similarity 78, member B, hypothetical protein LOC149297, MGC131653 |
| Gene, Accession # | FAM78B, Gene ID: 149297, Accession: Q5VT40, SwissProt: Q5VT40 |
| Catalog # | NBP1-55527-20ul |
| Price | |
| Order / More Info | FAM78B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |