| Edit |   |
| Antigenic Specificity | FAM81B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FAM81B Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM81B. This antibody reacts with human. The FAM81B Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to FAM81B(family with sequence similarity 81, member B) The peptide sequence was selected from the N terminal of FAM81B. Peptide sequence MQLQFLGTLASSEKRKKSQRLFFKNIKSTKNKAGKASIMSSDTNVNKSAS. |
| Other Names | family with sequence similarity 81, member B, FLJ25333, hypothetical protein LOC153643 |
| Gene, Accession # | FAM81B, Gene ID: 153643, Accession: Q96LP2, SwissProt: Q96LP2 |
| Catalog # | NBP1-56724-20ul |
| Price | |
| Order / More Info | FAM81B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |