| Edit |   |
| Antigenic Specificity | FAM83B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FAM83B Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM83B. This antibody reacts with human. The FAM83B Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the C terminal of human FAM83BThe immunogen for this antibody is FAM83B. Peptide sequence PRRKHSSSSNSQGSIHKSKEDVTVSPSQEINAPPDENKRTPSPGPVESKF. |
| Other Names | C6orf143, family with sequence similarity 83, member B, MGC126677, MGC138480 |
| Gene, Accession # | FAM83B, Gene ID: 222584, Accession: NP_001010872, SwissProt: NP_001010872 |
| Catalog # | NBP1-79546 |
| Price | |
| Order / More Info | FAM83B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |