| Edit |   |
|---|
| Antigenic Specificity | FAM84B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM84B Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM84B. This antibody reacts with human. The FAM84B Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human FAM84B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MGNQVEKLTHLSYKEVPTADPTGVDRDDGPRIGVSYIFSNDDEDVEPQPPPQGPDGGGLPDGGDGPPPPQPQPYD |
|---|
| Other Names | BCMP101neurological/sensory 2, Breast cancer membrane protein 101, breast cancer membrane-associated protein 101, family with sequence similarity 84, member B, NSE2Protein NSE2 |
|---|
| Gene, Accession # | FAM84B, Gene ID: 157638 |
|---|
| Catalog # | NBP2-57217 |
|---|
| Price | |
|---|
| Order / More Info | FAM84B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|