| 产品详情 |
| Edit |   |
| Antigenic Specificity | SKA1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SKA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SKA1. This antibody reacts with human. The SKA1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human SKA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ELLNKLELEIQYQEQTNNSLKELCESLEEDYKDIEHLKENIPSHLPQVTVTQSCVKGSDLDPEEPIKVEEPEPVKKPPKEQRSIKEM |
| Other Names | C18orf24, chromosome 18 open reading frame 24, MGC10200, spindle and kinetochore associated complex subunit 1, spindle and kinetochore-associated protein 1, spindle and KT (kinetochore) associated 1 |
| Gene, Accession # | SKA1, Gene ID: 220134 |
| Catalog # | NBP1-92391 |
| Price | |
| Order / More Info | SKA1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|