| Edit |   |
|---|
| Antigenic Specificity | SKA3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SKA3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SKA3. This antibody reacts with human. The SKA3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SKA3 (spindle and kinetochore associated complex subunit 3) The peptide sequence was selected from the middle region of SKA3. Peptide sequence EVEDRTSLVLNSDTCFENLTDPSSPTISSYENLLRTPTPPEVTKIPEDIL. |
|---|
| Other Names | spindle and kinetochore associated complex subunit 3, spindle and kinetochore-associated protein 3 |
|---|
| Gene, Accession # | SKA3, Gene ID: 221150 |
|---|
| Catalog # | NBP1-70703 |
|---|
| Price | |
|---|
| Order / More Info | SKA3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|