| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SKIV2L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SKIV2L Antibody from Novus Biologicals is a rabbit polyclonal antibody to SKIV2L. This antibody reacts with human. The SKIV2L Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SKIV2L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TGNSSKTQGELFLLLDSRGAFHTKGYYAAVEAKKERMSKHAQTFGAKQPTHQGGPAQDRGVYLSLLASLRTRAQLPVVV |
|---|
| Other Names | 170A, DDX13helicase SKI2W, EC 3.6.1, Helicase-like protein, HLPEC 3.6.4.-, SKI2, SKI2Wsuperkiller viralicidic activity 2 (S. cerevisiae homolog)-like, SKIV2, superkiller viralicidic activity 2-like (S. cerevisiae), W |
|---|
| Gene, Accession # | SKIV2L, Gene ID: 6499 |
|---|
| Catalog # | NBP2-47275 |
|---|
| Price | |
|---|
| Order / More Info | SKIV2L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|