| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SKIV2L2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SKIV2L2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SKIV2L2. This antibody reacts with human, mouse, rat. The SKIV2L2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat SKIV2L2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LVVDENGDFREDNFNTAMQVLRDAGDLAKGDQKGRKGGTKGPSNVFKIVKMIMERNFQPVIIFSFSKKDCEAYALQMTK |
|---|
| Other Names | ATP-dependent helicase SKIV2L2, Dob1, EC 3.6.1, EC 3.6.4.13, fSAP118, KIAA0052functional spliceosome-associated protein 118, MGC142069, Mtr4superkiller viralicidic activity 2-like 2, superkiller viralicidic activity 2-like 2 (S. cerevisiae) |
|---|
| Gene, Accession # | SKIV2L2, Gene ID: 23517, Accession: P42285, SwissProt: P42285 |
|---|
| Catalog # | NBP1-84995 |
|---|
| Price | |
|---|
| Order / More Info | SKIV2L2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|