| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TOMM22 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TOMM22 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TOMM22. This antibody reacts with human, mouse, rat. The TOMM22 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat TOMM22 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQK |
|---|
| Other Names | 1C9-2, hTom22, mitochondrial import receptor subunit TOM22 homolog, mitochondrial import receptor Tom22, MST065, TOM22MSTP065, Translocase of outer membrane 22 kDa subunit homolog, translocase of outer mitochondrial membrane 22 homolog (yeast) |
|---|
| Gene, Accession # | TOMM22, Gene ID: 56993, Accession: Q9NS69 |
|---|
| Catalog # | NBP1-80671 |
|---|
| Price | |
|---|
| Order / More Info | TOMM22 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22692546, 25800673 |
|---|
| 产品资料 |
|
|