| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Band 3 |
|---|
| Clone | 2D5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. This antibody is reactive against recombinant protein in WB and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Band 3 Antibody (2D5) from Novus Biologicals is a mouse monoclonal antibody to Band 3. This antibody reacts with human. The Band 3 Antibody (2D5) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | SLC4A1 (NP_000333.1 261 a.a. - 360 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYK |
|---|
| Other Names | AE 1, AE1MGC126619, Anion exchange protein 1, Anion exchanger 1, band 3 anion transport protein, BND3, CD233, CD233 antigen, DI, EMPB3, EPB3MGC126623, erythrocyte membrane protein band 3, erythroid anion exchange protein, FR, Froese blood group, MGC116750, MGC116753, RTA1A, Solute carrier family 4 member 1, solute carrier family 4, anion exchanger, member 1 (erythrocyte membraneprotein band 3, Diego blood group), solute carrier family 4, anion exchanger, number 1, SW, Swann blood group, Waldner blood group, WD, WD1, WR, Wright blood group |
|---|
| Gene, Accession # | SLC4A1, Gene ID: 6521, Accession: NP_000333, SwissProt: NP_000333 |
|---|
| Catalog # | H00006521-M02 |
|---|
| Price | |
|---|
| Order / More Info | Band 3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|