| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | BANF1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BANF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BANF1. This antibody reacts with human. The BANF1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human BANF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGC |
|---|
| Other Names | BAFMGC111161, barrier to autointegration factor 1, barrier-to-autointegration factor, BCRG1, BCRP1, Breakpoint cluster region protein 1, D14S1460 |
|---|
| Gene, Accession # | BANF1, Gene ID: 8815, Accession: O75531, SwissProt: O75531 |
|---|
| Catalog # | NBP2-38442 |
|---|
| Price | |
|---|
| Order / More Info | BANF1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|