| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | BANF1 |
|---|
| Clone | M2 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BANF1 Antibody (M2) from Novus Biologicals is a mouse monoclonal antibody to BANF1. This antibody reacts with human, mouse, rat. The BANF1 Antibody (M2) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | BANF1 (AAH05942, 1 a.a. - 89 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL |
|---|
| Other Names | BAFMGC111161, barrier to autointegration factor 1, barrier-to-autointegration factor, BCRG1, BCRP1, Breakpoint cluster region protein 1, D14S1460 |
|---|
| Gene, Accession # | BANF1, Gene ID: 8815, Accession: AAH05942, SwissProt: AAH05942 |
|---|
| Catalog # | H00008815-M07 |
|---|
| Price | |
|---|
| Order / More Info | BANF1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 20511217 |
|---|
| 产品资料 |
|
|