| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | BAP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BAP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BAP1. This antibody reacts with human. The BAP1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human BAP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKP |
|---|
| Other Names | BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase), BRCA1-associated protein 1, Cerebral protein 6, cerebral protein-13, cerebral protein-6, DKFZp686N04275, EC 3.4.19.12, FLJ35406, FLJ37180, hucep-6, KIAA0272HUCEP-13, ubiquitin carboxyl-terminal hydrolase BAP1, ubiquitin carboxy-terminal hydrolase, UCHL2 |
|---|
| Gene, Accession # | BAP1, Gene ID: 8314 |
|---|
| Catalog # | NBP2-55462 |
|---|
| Price | |
|---|
| Order / More Info | BAP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|