| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LSP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 25674539). For IHC-Paraffin, HIER pH 6 retrieval is recommended. For |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LSP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LSP1. This antibody reacts with human. The LSP1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human LSP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PRTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIETAGRTPKLARQASIELPSMAVASTK |
|---|
| Other Names | 47 kDa actin binding protein, 47 kDa actin-binding protein, 52 kDa phosphoprotein, F-actin binding and cytoskeleton associated protein, leufactin (leukocyte F-actin binding protein), leukocyte-specific protein 1, lymphocyte-specific protein 1, lymphocyte-specific protein pp52, pp52, WP34Lymphocyte-specific antigen WP34 |
|---|
| Gene, Accession # | LSP1, Gene ID: 4046 |
|---|
| Catalog # | NBP1-86852 |
|---|
| Price | |
|---|
| Order / More Info | LSP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25674539 |
|---|
| 产品资料 |
|
|