| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | alpha-Taxilin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The alpha-Taxilin Antibody from Novus Biologicals is a rabbit polyclonal antibody to alpha-Taxilin. This antibody reacts with human. The alpha-Taxilin Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human alpha-Taxilin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RNDLNKRVQDLSAGGQGSLTDSGPERRPEGPGAQAPSSPRVTEAPCYPGAPSTE |
|---|
| Other Names | alpha-taxilin, DKFZp451J0118, IL14, interleukin 14, MGC118870, MGC118871, RP4-622L5.4, taxilin alpha, TXLN |
|---|
| Gene, Accession # | TXLNA, Gene ID: 200081, Accession: P40222, SwissProt: P40222 |
|---|
| Catalog # | NBP1-91662 |
|---|
| Price | |
|---|
| Order / More Info | alpha-Taxilin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|