| Edit |   |
|---|
| Antigenic Specificity | Intra Acrosomal Protein |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Intra Acrosomal Protein Antibody from Novus Biologicals is a rabbit polyclonal antibody to Intra Acrosomal Protein. This antibody reacts with human. The Intra Acrosomal Protein Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human ACRV1. Peptide sequence MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPS. |
|---|
| Other Names | acrosomal protein SP-10, acrosomal vesicle protein 1D11S4365, SP-10, SPACA2, sperm protein 10 |
|---|
| Gene, Accession # | ACRV1, Gene ID: 56, Accession: NP_001603, SwissProt: NP_001603 |
|---|
| Catalog # | NBP1-79534 |
|---|
| Price | |
|---|
| Order / More Info | Intra Acrosomal Protein Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|