| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KIR3DL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot. This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KIR3DL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KIR3DL1. This antibody reacts with human. The KIR3DL1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | KIR3DL1 (NP_001077008.1, 1 a.a. - 382 a.a.) full-length human protein. MLLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHVPIFHGRIFQEGFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPMVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEWISKDPSRLVGQIHDGVSKANFSIGSMMRALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGLYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNLRHLHILIGTSVVKIPFTILLFFLLHRWCSNKKKCCCNGPRACREQK |
|---|
| Other Names | AMB11, CD158 antigen-like family member E, CD158E, CD158e antigen, CD158e1, CD158e1/2, CD158e2, cl-11, cl-2, HLA-BW4-specific inhibitory NK cell receptor, killer cell immunoglobulin-like receptor 3DL1, killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail1,nkat3, killer Ig receptor, KIR antigen 3DL1, KIR3DL1/S1, KIR3DS1, MGC119726, MGC119728, MGC126589, MGC126591, MHC class I NK cell receptor, Natural killer-associated transcript 3, NKAT-3, NKAT3KIR, NKB1B, NKB1CD158E1, NK-receptor, p70 killer cell inhibitory receptor, p70 natural killer cell receptor clones CL-2/CL-11, p70 NK receptor CL-2/CL-11 |
|---|
| Gene, Accession # | KIR3DL1, Gene ID: 3811, Accession: NP_001077008.1, SwissProt: NP_001077008.1 |
|---|
| Catalog # | H00003811-D01P |
|---|
| Price | |
|---|
| Order / More Info | KIR3DL1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|